PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco010782.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 902aa    MW: 99206.5 Da    PI: 4.8904
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco010782.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.94.2e-1257921248
                     HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     l +av+++ g++Wk+Ia++++  Rt+ qc +rwqk+l
      Aco010782.1 57 LCRAVQRFKGKNWKKIAECFP-DRTDVQCLHRWQKVL 92
                     789******************.************986 PP

2Myb_DNA-binding60.63.3e-1998144148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v+ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
      Aco010782.1  98 KGPWSKEEDDIIVEMVNKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 144
                      79******************************.*************97 PP

3Myb_DNA-binding44.53.5e-14150192145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT++E+  l++a+  +G++ W+   + ++ gRt++ +k++w+
      Aco010782.1 150 KEAWTQDEEIALIHAHSIYGNK-WAELTKFLP-GRTDNAIKNHWN 192
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.4225392IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-1953104IPR009057Homeodomain-like
SuperFamilySSF466891.22E-1354106IPR009057Homeodomain-like
SMARTSM007179.3E-45494IPR001005SANT/Myb domain
CDDcd001671.39E-85492No hitNo description
PfamPF002491.4E-95792IPR001005SANT/Myb domain
PROSITE profilePS5129431.7993148IPR017930Myb domain
SuperFamilySSF466893.74E-3195191IPR009057Homeodomain-like
SMARTSM007173.5E-1897146IPR001005SANT/Myb domain
PfamPF002491.6E-1798144IPR001005SANT/Myb domain
CDDcd001677.74E-16100144No hitNo description
Gene3DG3DSA:1.10.10.606.8E-27105147IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-20148199IPR009057Homeodomain-like
PROSITE profilePS5129418.972149199IPR017930Myb domain
SMARTSM007171.3E-13149197IPR001005SANT/Myb domain
PfamPF002493.2E-12150193IPR001005SANT/Myb domain
CDDcd001671.65E-10152192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 902 aa     Download sequence    Send to blast
MASDKGKGSK RGEASSSSTA AHGGSGQEVS RKRPLGTPYT IHHLVVITID IAKDAVLCRA  60
VQRFKGKNWK KIAECFPDRT DVQCLHRWQK VLNPDLVKGP WSKEEDDIIV EMVNKYGPKK  120
WSTIAQALPG RIGKQCRERW HNHLNPAINK EAWTQDEEIA LIHAHSIYGN KWAELTKFLP  180
GRTDNAIKNH WNSSVKKKVD SYRAMGLLSQ FHGLPHPENS PHFMSLSALA RQNSEDSGFK  240
DRQEVEDSSE CSQVSSMLMG YSQTDSKMDF IDQMCDDLQL GEDVNENNTH MDVDMAADEL  300
PDYESLGDET HTSLELPEAS HCSPLHFENY EVDSTLFPNA VELNMPIPEA DFPSESIVKS  360
DTWQDSMQGH ITATNVVNVD ILSGRNCQTN AYQVYAVSSS SMVDISYCQS LMNLVPPSFI  420
CPSEGNLVND IKTIGIPVGP ENSEIICVPA DIGLESDAPR QTFMEMMACG SPNSFGKTTP  480
LNKKQVVSTE EQRDGGSLFY EPPRFPGLDI PFVSCDLAFS GDLQQDYSPL GIRKLMMPST  540
YSLWDSPPKD GSPDAFLKSA AKSFVCTPSI MKKRQRELLS PLADKKSSTT NGEAFDSGPS  600
SCSADGDVPS SEYHKRKSEL SSIEKGNLGD VSVSGHEKGP NTAEQDGNAT DKEQTIGILI  660
ERNLNDLLFS PGHVGQYLKE QTSRSSNSNS NKVQSNDNDC GDQSSLPSTS AHGTSANSID  720
ILVEKRRPSI NVDFESLNIF ADTPGIKRGI ESPSAWKSPW FVNSLLPVQG HRIDTDVLYQ  780
DMGLFVSPGD RTYDAIGLMK QLSEQTAALV AEAHEVLASG NREASLDGRN SDKENLQNEN  840
IEPENKIETH QMPPNVMAEA RVLDFSGCAT PVRRAETEKT DWVGTSISSS SPSSYLMKNC  900
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-635319913159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-635319913159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795071.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
TrEMBLJ3NCE00.0J3NCE0_ORYBR; Uncharacterized protein
STRINGOB12G16480.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.12e-90Homeodomain-like protein